PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA61G00245
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family bZIP
Protein Properties Length: 319aa    MW: 35920.9 Da    PI: 6.9379
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA61G00245genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.21.2e-10191234548
                 CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 
                 kr +r   NR +A+rsR RK+++i eLe+ v +L++e + L  +
  AA61G00245 191 KRVKRILANRQSAQRSRVRKLQYISELERSVTSLQTEVSVLSPR 234
                 899********************************998777655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.1E-13187251IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.588189241IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.3E-13191242No hitNo description
PfamPF001703.3E-9191234IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.13E-11191245No hitNo description
CDDcd147034.08E-24192242No hitNo description
PROSITE patternPS000360194209IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MATTTSPHWP DFSSQKSPFS TAPNAQTATA PNANANGQQN NVSWMDEFLD FSATRRGTHR  60
RSISDSIAFL EAPTGTNHHF DRFDDEQFMS MFNDDLHHHN NNNHNNIHRN VGPTASSSNT  120
STPSDHNSLS DDDNKPPPPS DHNNNNTNNN NNNNYNETDE VQSQCKTEPQ DSPSGNQNSG  180
GSSGNRIHDP KRVKRILANR QSAQRSRVRK LQYISELERS VTSLQTEVSV LSPRVAFLDH  240
QRLLLNVDNS ALKQRIAALA QDKIFKDAHQ EALKREIERL RQVYHQQSLK KMENNNNVSD  300
QSPVTDIKPA VEKEQLLNA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006402806.11e-170hypothetical protein EUTSA_v10006090mg
SwissprotQ9M2K41e-165BZP61_ARATH; Basic leucine zipper 61
TrEMBLV4LKJ51e-170V4LKJ5_EUTSA; Uncharacterized protein
STRINGAT3G58120.11e-163(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17532777
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42380.11e-97bZIP family protein